(data stored in SCRATCH zone)

EMBL: CP002293.PE405

CP002293.PE405       Location/Qualifiers
FT   CDS             457411..458151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0421"
FT                   /product="carboxylesterase"
FT                   /note="KEGG: gwc:GWCH70_2956 carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73261"
FT                   /db_xref="GOA:A0A0F6BIL0"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL0"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2956"
FT                   /protein_id="ADP73261.1"
FT                   /translation="MKVVPPKPFTFEAGERAVLLLHGFTGNSSDVRMLGRFLEAKGYTC
FT                   HAPIYKGHGVPPEELVHTGPDDWWQDVINAYEFLKNKGYEKIAVAGLSLGGVFSLKLGY
FT                   TVPVVGIIPMCAPMYIKSEETMYEGVLKYAREYKKREGKTPEQIEEEMEAFQKTPMKTL
FT                   KALQQLIADVRERIDLIYAPTFVVQARHDEMINPDSANIIYNGIESPVKKIKWYEESGH
FT                   VITLDKEKEQLHEDIYEFLESLDW"
     MKVVPPKPFT FEAGERAVLL LHGFTGNSSD VRMLGRFLEA KGYTCHAPIY KGHGVPPEEL        60
     VHTGPDDWWQ DVINAYEFLK NKGYEKIAVA GLSLGGVFSL KLGYTVPVVG IIPMCAPMYI       120
     KSEETMYEGV LKYAREYKKR EGKTPEQIEE EMEAFQKTPM KTLKALQQLI ADVRERIDLI       180
     YAPTFVVQAR HDEMINPDSA NIIYNGIESP VKKIKWYEES GHVITLDKEK EQLHEDIYEF       240
     LESLDW                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page