(data stored in ACNUC7421 zone)

EMBL: CP002293.PE406

CP002293.PE406       Location/Qualifiers
FT   CDS             458179..460464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0422"
FT                   /product="ribonuclease R"
FT                   /note="TIGRFAM: ribonuclease R; VacB and RNase II family
FT                   3'-5' exoribonuclease; PFAM: ribonuclease II; RNA binding
FT                   S1 domain protein; Ribonuclease B OB region domain; KEGG:
FT                   gwc:GWCH70_2955 ribonuclease R; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73262"
FT                   /db_xref="GOA:A0A0F6BIL1"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL1"
FT                   /inference="protein motif:TFAM:TIGR02063"
FT                   /protein_id="ADP73262.1"
FT                   /translation="MDQSLVERILTFMQDEAYKPLTVQELEEAFGITDAAAFKEFVKAL
FT                   VAMEEQGLVVRTRSNRYGVPEKMNLVRGKVSGHAKGFAFVVPDDPELDDIFIPPSEMKN
FT                   AMHGDTVLVRVHADSSGARREGTIVRILERGVTEVVGTYTESKYFGFVIPDDKKIVNDI
FT                   FIPKHAANGAVEGHKVVVRLTSYPQGRMSAEGEVVKILGHKNDPGVDILSIIHKHGLPL
FT                   QFPDEVLEHANRISDTISEKDLQGRRDLRDQMIVTIDGEDAKDLDDAVTVTKLANGHYK
FT                   LGVHIADVSYYVEEGSPIDREAYERGTSVYLVDRVIPMIPHRLSNGICSLNPKVDRLTI
FT                   SCEMEINERGEVVSHEIFQSVIRTTERMTYSDVNKILVDKDEELRKKYAPLVPMFELMA
FT                   ELAEILRNKRMKRGAIDFDFKEAKVLVDENGKPYDVVLRERSVAERLIEEFMLAANETV
FT                   AEHFHWLNVPFIYRVHEDPKPEKLQRFLEFITNFGYVVKGTGNQIHPRALQEILEAVRG
FT                   EPEEMLISTVMLRSMKQARYDAESLGHYGLSTDFYTHFTSPIRRYPDLIVHRLIRTYLI
FT                   NGQMDEQTQQKWAEKLPDIAAHASNMERRAVEAERETDDLKKTEFMEDKIGMEFDGIIS
FT                   SVTNFGLFVELPNTIEGLVHVSYLTDDYYHYDERSYAMIGERTGKVYRIGDQITVRVIN
FT                   VNKDERIVDFEIVGMKDRRRKEPKHAPVVIEGKKRKKRNKDEKTKKAKKFYEDIPKLKA
FT                   KKKKKKKK"
     MDQSLVERIL TFMQDEAYKP LTVQELEEAF GITDAAAFKE FVKALVAMEE QGLVVRTRSN        60
     RYGVPEKMNL VRGKVSGHAK GFAFVVPDDP ELDDIFIPPS EMKNAMHGDT VLVRVHADSS       120
     GARREGTIVR ILERGVTEVV GTYTESKYFG FVIPDDKKIV NDIFIPKHAA NGAVEGHKVV       180
     VRLTSYPQGR MSAEGEVVKI LGHKNDPGVD ILSIIHKHGL PLQFPDEVLE HANRISDTIS       240
     EKDLQGRRDL RDQMIVTIDG EDAKDLDDAV TVTKLANGHY KLGVHIADVS YYVEEGSPID       300
     REAYERGTSV YLVDRVIPMI PHRLSNGICS LNPKVDRLTI SCEMEINERG EVVSHEIFQS       360
     VIRTTERMTY SDVNKILVDK DEELRKKYAP LVPMFELMAE LAEILRNKRM KRGAIDFDFK       420
     EAKVLVDENG KPYDVVLRER SVAERLIEEF MLAANETVAE HFHWLNVPFI YRVHEDPKPE       480
     KLQRFLEFIT NFGYVVKGTG NQIHPRALQE ILEAVRGEPE EMLISTVMLR SMKQARYDAE       540
     SLGHYGLSTD FYTHFTSPIR RYPDLIVHRL IRTYLINGQM DEQTQQKWAE KLPDIAAHAS       600
     NMERRAVEAE RETDDLKKTE FMEDKIGMEF DGIISSVTNF GLFVELPNTI EGLVHVSYLT       660
     DDYYHYDERS YAMIGERTGK VYRIGDQITV RVINVNKDER IVDFEIVGMK DRRRKEPKHA       720
     PVVIEGKKRK KRNKDEKTKK AKKFYEDIPK LKAKKKKKKK K                           761
//

If you have problems or comments...

PBIL Back to PBIL home page