(data stored in SCRATCH zone)

EMBL: CP002293.PE409

CP002293.PE409       Location/Qualifiers
FT   CDS             463680..464243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0425"
FT                   /product="3D domain-containing protein"
FT                   /note="KEGG: hypothetical protein; PFAM: 3D
FT                   domain-containing protein; Peptidoglycan-binding lysin
FT                   domain; SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73265"
FT                   /db_xref="GOA:A0A0F6BIL4"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL4"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADP73265.1"
FT                   /translation="MKKLLLSITSSFFLAFGFSGAASAAGTYQVKSGDTLWNIAKKHKV
FT                   TVSQLKSWNNLKSDLIKPKQVLKILGTTTKAAAKTTVKKEAAKTAAYKTITVKAYAYTV
FT                   NCKGCSGITATGLNLKKNPSLKVIAVDPKVIPLGSKVYVEGYGYAVAADKGGGIRGNKI
FT                   DVFMPTKAKAIQWGVRTVKVKVYK"
     MKKLLLSITS SFFLAFGFSG AASAAGTYQV KSGDTLWNIA KKHKVTVSQL KSWNNLKSDL        60
     IKPKQVLKIL GTTTKAAAKT TVKKEAAKTA AYKTITVKAY AYTVNCKGCS GITATGLNLK       120
     KNPSLKVIAV DPKVIPLGSK VYVEGYGYAV AADKGGGIRG NKIDVFMPTK AKAIQWGVRT       180
     VKVKVYK                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page