(data stored in ACNUC7421 zone)

EMBL: CP002293.PE410

CP002293.PE410       Location/Qualifiers
FT   CDS             complement(464309..464455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73266.1"
FT                   /translation="MFIEGRYTRNLGGKGSLSVSLLSSAAKIKAQNLLYFIYPSEFMKL
FT                   SKL"
     MFIEGRYTRN LGGKGSLSVS LLSSAAKIKA QNLLYFIYPS EFMKLSKL                     48
//

If you have problems or comments...

PBIL Back to PBIL home page