(data stored in ACNUC7421 zone)

EMBL: CP002293.PE412

CP002293.PE412       Location/Qualifiers
FT   CDS             465297..467264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL7"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0414"
FT                   /protein_id="ADP73268.1"
FT                   /translation="MEGAEEFVSNEEVLNTDILRARIMNVEYQNLTISEIKREIRRIYI
FT                   EETGKEPPANITIYRSDDFKNLNDIDSGFDGTVIHFYDEEKGINQSYTITRGSEAPEKD
FT                   TWKPLDWTYNVFGIFVGQNRSQYDAALRFDQIVTQKINEKIGRSDNKIKLKKIGLGHSL
FT                   GGNLNETIQLTEKRYEKVYVINDAPPSFYQLATIDEYFWGQLVKKFNLNFDHYEEIYSI
FT                   PPSKLKSFAEEYYKKQIDERSIYHLTAEEDLLYAVSGVRGFIDIGSRQFIDTNKGFTSI
FT                   KDLIAKISDKDVRAIQLYLSQYSDVYNEKGFDGVVQAMTGGDIAFIESLQGYDSMDYVW
FT                   HAGDIVSKANHMLDDMKVKIPELMKNVAILYKNLDPIFSVFVELGYVTPEEKKTVLSEV
FT                   KGIEKDVASIQQLLRKTWNWRMAIPFLTPLVTDDILQWKASIEVLFQIRDKVLDILKRL
FT                   QIIQENTKNLQNAITISVNAHSLNDVIMALARSKGRTYDKYGNLILIKKVGDHEIRMNL
FT                   SSAVRIYQKGLQILEEKETVLHEMKQRYFDEYVEDFEMQKRKLLNKINDMEQNPWAYQH
FT                   LLGHFTYDAEQVHVLRRIDVHESIPPLDPMIPHIFETMFSYYEQEISKGKELIATIKKS
FT                   FEEFFEQDQNVSKIFDLRYG"
     MEGAEEFVSN EEVLNTDILR ARIMNVEYQN LTISEIKREI RRIYIEETGK EPPANITIYR        60
     SDDFKNLNDI DSGFDGTVIH FYDEEKGINQ SYTITRGSEA PEKDTWKPLD WTYNVFGIFV       120
     GQNRSQYDAA LRFDQIVTQK INEKIGRSDN KIKLKKIGLG HSLGGNLNET IQLTEKRYEK       180
     VYVINDAPPS FYQLATIDEY FWGQLVKKFN LNFDHYEEIY SIPPSKLKSF AEEYYKKQID       240
     ERSIYHLTAE EDLLYAVSGV RGFIDIGSRQ FIDTNKGFTS IKDLIAKISD KDVRAIQLYL       300
     SQYSDVYNEK GFDGVVQAMT GGDIAFIESL QGYDSMDYVW HAGDIVSKAN HMLDDMKVKI       360
     PELMKNVAIL YKNLDPIFSV FVELGYVTPE EKKTVLSEVK GIEKDVASIQ QLLRKTWNWR       420
     MAIPFLTPLV TDDILQWKAS IEVLFQIRDK VLDILKRLQI IQENTKNLQN AITISVNAHS       480
     LNDVIMALAR SKGRTYDKYG NLILIKKVGD HEIRMNLSSA VRIYQKGLQI LEEKETVLHE       540
     MKQRYFDEYV EDFEMQKRKL LNKINDMEQN PWAYQHLLGH FTYDAEQVHV LRRIDVHESI       600
     PPLDPMIPHI FETMFSYYEQ EISKGKELIA TIKKSFEEFF EQDQNVSKIF DLRYG            655
//

If you have problems or comments...

PBIL Back to PBIL home page