(data stored in ACNUC7421 zone)

EMBL: CP002293.PE413

CP002293.PE413       Location/Qualifiers
FT   CDS             467280..467612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL8"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0415"
FT                   /protein_id="ADP73269.1"
FT                   /translation="MGQLNMFYHFDVEQDFMYKANTFIQQLNRMSELDAELVHLIHQEM
FT                   KYGRGQIIDKTNEAVEQYQKRNLLSNDLYKNSMNTAAQRYTNMINDMRGQHITLYYDVI
FT                   IREKKR"
     MGQLNMFYHF DVEQDFMYKA NTFIQQLNRM SELDAELVHL IHQEMKYGRG QIIDKTNEAV        60
     EQYQKRNLLS NDLYKNSMNT AAQRYTNMIN DMRGQHITLY YDVIIREKKR                  110
//

If you have problems or comments...

PBIL Back to PBIL home page