(data stored in SCRATCH zone)

EMBL: CP002293.PE414

CP002293.PE414       Location/Qualifiers
FT   CDS             467678..468679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73270"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL9"
FT                   /inference="similar to AA sequence:KEGG:CA_C3721"
FT                   /protein_id="ADP73270.1"
FT                   /translation="MVLSRTEGRMIMKTYRAVLAAITMLVSLVLFGCTHEETRSKKPGE
FT                   ESETRVKIPSDKELIAIIDDNLKAFDEGNVDKYMETIHTQSPLYEQSRKLVEEISKAYK
FT                   LKTEISNVEVMEKSEKEAKVKFTQKTVKIEGPAFRDNEITGYHVLRPEKGTWKIYNTVM
FT                   TKSVFLDENGNPLETNGQDGKNQIEQMDLKFDERKWVLDHFDSANGESIWEFVLEGESV
FT                   ENWTELYTIHRFEKMNSTVGLKSWLEAYKQALAEATNGHFTFHTFESTGQEEIYEFIVK
FT                   DAKVQDDQHEVARLFAQGDDLYLVRYTKLGEAMPDKTRDEWIQRLKQFKAQK"
     MVLSRTEGRM IMKTYRAVLA AITMLVSLVL FGCTHEETRS KKPGEESETR VKIPSDKELI        60
     AIIDDNLKAF DEGNVDKYME TIHTQSPLYE QSRKLVEEIS KAYKLKTEIS NVEVMEKSEK       120
     EAKVKFTQKT VKIEGPAFRD NEITGYHVLR PEKGTWKIYN TVMTKSVFLD ENGNPLETNG       180
     QDGKNQIEQM DLKFDERKWV LDHFDSANGE SIWEFVLEGE SVENWTELYT IHRFEKMNST       240
     VGLKSWLEAY KQALAEATNG HFTFHTFEST GQEEIYEFIV KDAKVQDDQH EVARLFAQGD       300
     DLYLVRYTKL GEAMPDKTRD EWIQRLKQFK AQK                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page