(data stored in SCRATCH zone)

EMBL: CP002293.PE417

CP002293.PE417       Location/Qualifiers
FT   CDS             469819..471159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0433"
FT                   /product="Protein of unknown function EssB"
FT                   /note="PFAM: Protein of unknown function EssB; KEGG:
FT                   gtn:GTNG_0418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73273"
FT                   /db_xref="GOA:A0A0F6BIM2"
FT                   /db_xref="InterPro:IPR018778"
FT                   /db_xref="InterPro:IPR042565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM2"
FT                   /inference="protein motif:PFAM:PF10140"
FT                   /protein_id="ADP73273.1"
FT                   /translation="MEEKKTYLETQIDAVMTKDKHYTIIFQRAKLRMQHPLELQIVKEI
FT                   DSYLLRDIDISEDEVKITITPPASCFPFPVVRKKSLLSRLRAAYQLVTKVKNHSRRRFI
FT                   LIVCPENLVFDHGLEPFFLHVGIKESLPPYEPDEARLLQEVKATVLALTDGQYQFEEYL
FT                   KFHETLKYSAIAKEMLQAENLETLLSILERWMDEEEAKEQSSVHIPKRKWNVQRYIFFS
FT                   IVALLIPAIIYMFYSVFFLQPKQKAYVQSAELFLQNKYSDVITALENYPPEKMPYVVQY
FT                   ELASSYVMTESLTEEQRKVVLNNITLKTDPQYLLYWIYIGRGRSEEAIELARAMEDREL
FT                   IVYGLLKHREEIKADEKLSGEEKKQKLEEIDREIEEYKREREEQEQQSEEEEKQEEPNQ
FT                   QQPPAQQPAATPPASTAPNQQQSTTPAPNHTPPASNSVPPNNVETKQ"
     MEEKKTYLET QIDAVMTKDK HYTIIFQRAK LRMQHPLELQ IVKEIDSYLL RDIDISEDEV        60
     KITITPPASC FPFPVVRKKS LLSRLRAAYQ LVTKVKNHSR RRFILIVCPE NLVFDHGLEP       120
     FFLHVGIKES LPPYEPDEAR LLQEVKATVL ALTDGQYQFE EYLKFHETLK YSAIAKEMLQ       180
     AENLETLLSI LERWMDEEEA KEQSSVHIPK RKWNVQRYIF FSIVALLIPA IIYMFYSVFF       240
     LQPKQKAYVQ SAELFLQNKY SDVITALENY PPEKMPYVVQ YELASSYVMT ESLTEEQRKV       300
     VLNNITLKTD PQYLLYWIYI GRGRSEEAIE LARAMEDREL IVYGLLKHRE EIKADEKLSG       360
     EEKKQKLEEI DREIEEYKRE REEQEQQSEE EEKQEEPNQQ QPPAQQPAAT PPASTAPNQQ       420
     QSTTPAPNHT PPASNSVPPN NVETKQ                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page