(data stored in ACNUC7421 zone)

EMBL: CP002293.PE419

CP002293.PE419       Location/Qualifiers
FT   CDS             475662..478448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73275"
FT                   /db_xref="GOA:A0A0F6BIM4"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM4"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0420"
FT                   /protein_id="ADP73275.1"
FT                   /translation="MTEKWKIVKLIAKIVFIVALPVLFFTFIGHNPMKVTERTTNRIAV
FT                   VNEDVGADYNKKTYEFGKEIVPALDDDSDYQWSVVNRSQAEKGLADGQYDAVVYLPSDF
FT                   SRNILTFNEKKPLKATIQYKIQPNLEAKNREQVQRELEAAKNTINQKMSTLYWSYVGQA
FT                   VEDIRKKFSAILEKEIAFQKTMYDFYTPSSAKLTKEIESQKKMLEQLLSSSKNAESSSN
FT                   DTLKGLEQAEAEIASFIEDIQMYKEYQQRQHDIIQQGIRQYETMISGGLRSVVERPWNV
FT                   RPELELSSQTLLQSVSKLRNMVTDSHTALTSLYNQLENSNVYERLLESQKDLIRQYQQQ
FT                   TDAKILDEVQQKLIPLRQRLQSATAPSAPNEQPGPGELPQPSGNGQWLDRLEQQLASLK
FT                   TELRTAKPQLPQETKEGQDASGSWGDIDNAINQLEVEMQKAKEAWQKQLAFEQQWQEKY
FT                   AQLAKQLAALANNDSGQSEETVVQQIVEKEQAILQSPSLSEERKQQLSAQFQPAIQSRN
FT                   MNDLLAYFYWLSVFEDTLKRMENFDEALVDQLILNWKEKADIFQTLLNIHSGIYQLQDG
FT                   SATSLHGAEAVENNVHSFVEVTFEYDKNVKKMQAELMGQLQSLNDAANEVTAQLQQTMD
FT                   EEGTIQSTVGADNGEFVIAIQQNTLQDITQISDLVTSIAEGQDRIIDYTNEMHEKVASV
FT                   QGRADELNNKWATNVNTTKQIKNDVYRLLDNTMVDKQTNGYVYDYLTNPVQVSGDIPKE
FT                   KATYTPPVVMLVIVLLCGMLIGFFLHYYSSVPLMLQLALLIIMNLLVGFIISTYGLRIY
FT                   PMQEVQALKWSIFTIILLFFCSAIVRLAFFIGPFTGWVLGVGLILFFITPLLDLVLPNF
FT                   RFDHPISETYMSIQYGDQQAFYPAVITLGVVTVLMSAVPFLKQRLDALQKEAETYEG"
     MTEKWKIVKL IAKIVFIVAL PVLFFTFIGH NPMKVTERTT NRIAVVNEDV GADYNKKTYE        60
     FGKEIVPALD DDSDYQWSVV NRSQAEKGLA DGQYDAVVYL PSDFSRNILT FNEKKPLKAT       120
     IQYKIQPNLE AKNREQVQRE LEAAKNTINQ KMSTLYWSYV GQAVEDIRKK FSAILEKEIA       180
     FQKTMYDFYT PSSAKLTKEI ESQKKMLEQL LSSSKNAESS SNDTLKGLEQ AEAEIASFIE       240
     DIQMYKEYQQ RQHDIIQQGI RQYETMISGG LRSVVERPWN VRPELELSSQ TLLQSVSKLR       300
     NMVTDSHTAL TSLYNQLENS NVYERLLESQ KDLIRQYQQQ TDAKILDEVQ QKLIPLRQRL       360
     QSATAPSAPN EQPGPGELPQ PSGNGQWLDR LEQQLASLKT ELRTAKPQLP QETKEGQDAS       420
     GSWGDIDNAI NQLEVEMQKA KEAWQKQLAF EQQWQEKYAQ LAKQLAALAN NDSGQSEETV       480
     VQQIVEKEQA ILQSPSLSEE RKQQLSAQFQ PAIQSRNMND LLAYFYWLSV FEDTLKRMEN       540
     FDEALVDQLI LNWKEKADIF QTLLNIHSGI YQLQDGSATS LHGAEAVENN VHSFVEVTFE       600
     YDKNVKKMQA ELMGQLQSLN DAANEVTAQL QQTMDEEGTI QSTVGADNGE FVIAIQQNTL       660
     QDITQISDLV TSIAEGQDRI IDYTNEMHEK VASVQGRADE LNNKWATNVN TTKQIKNDVY       720
     RLLDNTMVDK QTNGYVYDYL TNPVQVSGDI PKEKATYTPP VVMLVIVLLC GMLIGFFLHY       780
     YSSVPLMLQL ALLIIMNLLV GFIISTYGLR IYPMQEVQAL KWSIFTIILL FFCSAIVRLA       840
     FFIGPFTGWV LGVGLILFFI TPLLDLVLPN FRFDHPISET YMSIQYGDQQ AFYPAVITLG       900
     VVTVLMSAVP FLKQRLDALQ KEAETYEG                                          928
//

If you have problems or comments...

PBIL Back to PBIL home page