(data stored in ACNUC7421 zone)

EMBL: CP002293.PE425

CP002293.PE425       Location/Qualifiers
FT   CDS             482638..482751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73281"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN0"
FT                   /inference="similar to AA sequence:KEGG:GK0782"
FT                   /protein_id="ADP73281.1"
FT                   /translation="MGDAQNIFNHFKLEGKVCLLQNKNTEFCKENVQSLIG"
     MGDAQNIFNH FKLEGKVCLL QNKNTEFCKE NVQSLIG                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page