(data stored in ACNUC7421 zone)

EMBL: CP002293.PE426

CP002293.PE426       Location/Qualifiers
FT   CDS             484328..485068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0445"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="manually curated; PFAM: IstB domain protein
FT                   ATP-binding protein; KEGG: gyc:GYMC61_2739 IstB domain
FT                   protein ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73282"
FT                   /db_xref="GOA:A0A0F6BMA2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BMA2"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADP73282.1"
FT                   /translation="MTRDIKEICKALHLAYIADRFEEVPYETKEQFLRDVLALEVSSRQ
FT                   EAKRSKLIKKAKFRELKWLKDYEWSDHIHWPSTTTKEELCDLVFLERRQNVLLLGSPGT
FT                   GKTHLATALGLKACEKGHEVRFFRVADLVAQLEEALKNGTLPRLKRQIETCELLILDEL
FT                   GYVPFQKQGSELLFHIIADCYERKSVIVTSNLEFGQWNRVFGDNRLTAALVDRLVHHAH
FT                   IIAFTGESYRLRHALSSVKKISSN"
     MTRDIKEICK ALHLAYIADR FEEVPYETKE QFLRDVLALE VSSRQEAKRS KLIKKAKFRE        60
     LKWLKDYEWS DHIHWPSTTT KEELCDLVFL ERRQNVLLLG SPGTGKTHLA TALGLKACEK       120
     GHEVRFFRVA DLVAQLEEAL KNGTLPRLKR QIETCELLIL DELGYVPFQK QGSELLFHII       180
     ADCYERKSVI VTSNLEFGQW NRVFGDNRLT AALVDRLVHH AHIIAFTGES YRLRHALSSV       240
     KKISSN                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page