(data stored in ACNUC7421 zone)

EMBL: CP002293.PE427

CP002293.PE427       Location/Qualifiers
FT   CDS             485996..486880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0447"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: gwc:GWCH70_0294 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73283"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN2"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0294"
FT                   /protein_id="ADP73283.1"
FT                   /translation="MLTIRVNPEELETVAKHVPDAEDGCSRARTSLSWELPSLVMEIPG
FT                   IGSAAIQELTDELLHWLRRYEEKLNEAEELLYRTAAAIRQADQTLADNMKEFGLELLGW
FT                   YDLQRVFGEYDPITGERISGWDRLVAGGMLLLSVIPPAKGAGVAGKAVIKGAKAAETAA
FT                   DVSKWISKTRNVLNVNKIKGALQTIYHQVIKGPITETIRSFKHQWENFLENVGSVLQGP
FT                   QLAADGVEVVPSGRMIGIAEESASSVRVSMSQAGDEVVGKGIGKGKNESPRNKPGVVSE
FT                   SFKFDRSLQSKQN"
     MLTIRVNPEE LETVAKHVPD AEDGCSRART SLSWELPSLV MEIPGIGSAA IQELTDELLH        60
     WLRRYEEKLN EAEELLYRTA AAIRQADQTL ADNMKEFGLE LLGWYDLQRV FGEYDPITGE       120
     RISGWDRLVA GGMLLLSVIP PAKGAGVAGK AVIKGAKAAE TAADVSKWIS KTRNVLNVNK       180
     IKGALQTIYH QVIKGPITET IRSFKHQWEN FLENVGSVLQ GPQLAADGVE VVPSGRMIGI       240
     AEESASSVRV SMSQAGDEVV GKGIGKGKNE SPRNKPGVVS ESFKFDRSLQ SKQN             294
//

If you have problems or comments...

PBIL Back to PBIL home page