(data stored in SCRATCH zone)

EMBL: CP002293.PE431

CP002293.PE431       Location/Qualifiers
FT   CDS             488622..489104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0451"
FT                   /product="protein of unknown function DUF600"
FT                   /note="PFAM: protein of unknown function DUF600; KEGG:
FT                   bld:BLi01314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73287"
FT                   /db_xref="InterPro:IPR006728"
FT                   /db_xref="InterPro:IPR036170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN6"
FT                   /inference="protein motif:PFAM:PF04634"
FT                   /protein_id="ADP73287.1"
FT                   /translation="MDDLKLNNIYQKIAHTIIETIPEEWSKVFVYGEITEDVRTAFFYY
FT                   YPANGSTPIYSHDIPNIFAIEKEDYKKLWRQLLDNLEELWREFKNNGQDPWTNLTLIFD
FT                   NQGNFKIEYDYEDLSDADDHERSIIWEYKYLGLTPEDEDDKKFLEEYLNSIKENDQ"
     MDDLKLNNIY QKIAHTIIET IPEEWSKVFV YGEITEDVRT AFFYYYPANG STPIYSHDIP        60
     NIFAIEKEDY KKLWRQLLDN LEELWREFKN NGQDPWTNLT LIFDNQGNFK IEYDYEDLSD       120
     ADDHERSIIW EYKYLGLTPE DEDDKKFLEE YLNSIKENDQ                             160
//

If you have problems or comments...

PBIL Back to PBIL home page