(data stored in ACNUC7421 zone)

EMBL: CP002293.PE432

CP002293.PE432       Location/Qualifiers
FT   CDS             489974..490876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73288"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN7"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0423"
FT                   /protein_id="ADP73288.1"
FT                   /translation="MKQKKLLYRTAAAISQADQTLADNMKEFGMELSGWYDLQRVFGEY
FT                   DPVTGERISVGDRLFAGGMLLLSIIPPAKGAGVAGKAGIKGLKAAETAAEVLKWISKTK
FT                   NVLNVDKIKGAFQTIYHQVIKGPITETIRSFKKQWENFLENVGSVLMGPELAIDGVGAV
FT                   PSGRMIGIAEESASSVRISMSQVGGEVGKEAGGAVYKGTGKLSRRDQLLNQVTNKKLRN
FT                   TINEMFRPTATVGDGSLAAAVRLEAKKGILTGGKSHIQKAKERIRNLENILMKENLDPK
FT                   EREIANDLLIELKRALNGK"
     MKQKKLLYRT AAAISQADQT LADNMKEFGM ELSGWYDLQR VFGEYDPVTG ERISVGDRLF        60
     AGGMLLLSII PPAKGAGVAG KAGIKGLKAA ETAAEVLKWI SKTKNVLNVD KIKGAFQTIY       120
     HQVIKGPITE TIRSFKKQWE NFLENVGSVL MGPELAIDGV GAVPSGRMIG IAEESASSVR       180
     ISMSQVGGEV GKEAGGAVYK GTGKLSRRDQ LLNQVTNKKL RNTINEMFRP TATVGDGSLA       240
     AAVRLEAKKG ILTGGKSHIQ KAKERIRNLE NILMKENLDP KEREIANDLL IELKRALNGK       300
//

If you have problems or comments...

PBIL Back to PBIL home page