(data stored in ACNUC7421 zone)

EMBL: CP002293.PE433

CP002293.PE433       Location/Qualifiers
FT   CDS             490866..491255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_2115 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73289"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN8"
FT                   /inference="similar to AA sequence:KEGG:Gura_2115"
FT                   /protein_id="ADP73289.1"
FT                   /translation="MENRLEGIIIITVDVFTKKFLELFPEYQASYIEHIEFNGELLPHV
FT                   FFGETLNEDLPALINSGKEEKLRSIFDFIEFMLKKGDTDVQEVITLTILARLGDEPEIL
FT                   KKALKYMGTETRKASKEIETFWGRQ"
     MENRLEGIII ITVDVFTKKF LELFPEYQAS YIEHIEFNGE LLPHVFFGET LNEDLPALIN        60
     SGKEEKLRSI FDFIEFMLKK GDTDVQEVIT LTILARLGDE PEILKKALKY MGTETRKASK       120
     EIETFWGRQ                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page