(data stored in SCRATCH zone)

EMBL: CP002293.PE435

CP002293.PE435       Location/Qualifiers
FT   CDS             complement(495556..496791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0457"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG:
FT                   gwc:GWCH70_1766 transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73291"
FT                   /db_xref="GOA:A0A0F6BLG8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BLG8"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADP73291.1"
FT                   /translation="MAQYHITLNDELLHGLFTRDEGLAKLLEQVLNQILEAQVEEQLGA
FT                   RRYERTEERKGYRNGSYPRQLTTRVGRLTLRVPRTRDGEFSTELFQRYQRSEQALVLAL
FT                   MEMVVNGVSTRKITQITEELCGTSFSKSTVSSLCKGLDPIIQDWNYRSLHEHVYPFVLV
FT                   DAIYTKVREDGRVRSRAVLIATGVNEEGYREILGLQIGNSESESSWSEFFGWLKDRGLR
FT                   GVDLIISDQHGGLVQAIEKHFQGATWQRCQTHFIRNILDAAPKYMQDALLEEIRGILHA
FT                   PNKQTARLLLEQVLAKWEEKAPKAMQILEEGFEDATAVLDYPDRYRRRLRTTNGVERLN
FT                   EEIRRRERVIRIFPNRESVYRLVGAVLIEIDEKWMSGRKYLDMSEYWRWRKMKEQGVRS
FT                   VNQEAPAIKRVG"
     MAQYHITLND ELLHGLFTRD EGLAKLLEQV LNQILEAQVE EQLGARRYER TEERKGYRNG        60
     SYPRQLTTRV GRLTLRVPRT RDGEFSTELF QRYQRSEQAL VLALMEMVVN GVSTRKITQI       120
     TEELCGTSFS KSTVSSLCKG LDPIIQDWNY RSLHEHVYPF VLVDAIYTKV REDGRVRSRA       180
     VLIATGVNEE GYREILGLQI GNSESESSWS EFFGWLKDRG LRGVDLIISD QHGGLVQAIE       240
     KHFQGATWQR CQTHFIRNIL DAAPKYMQDA LLEEIRGILH APNKQTARLL LEQVLAKWEE       300
     KAPKAMQILE EGFEDATAVL DYPDRYRRRL RTTNGVERLN EEIRRRERVI RIFPNRESVY       360
     RLVGAVLIEI DEKWMSGRKY LDMSEYWRWR KMKEQGVRSV NQEAPAIKRV G                411
//

If you have problems or comments...

PBIL Back to PBIL home page