(data stored in ACNUC7421 zone)

EMBL: CP002293.PE436

CP002293.PE436       Location/Qualifiers
FT   CDS             497058..497300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0458"
FT                   /product="Protein of unknown function DUF2642"
FT                   /note="PFAM: Protein of unknown function DUF2642; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73292"
FT                   /db_xref="InterPro:IPR020139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP1"
FT                   /inference="protein motif:PFAM:PF10842"
FT                   /protein_id="ADP73292.1"
FT                   /translation="MTMNQPHYSYPSSPQLVALVDPYVYQTLQSIVGREVVVETARGSV
FT                   QGMLREVRPDHIILSSNRTTLFIRIQQIVWIRLTN"
     MTMNQPHYSY PSSPQLVALV DPYVYQTLQS IVGREVVVET ARGSVQGMLR EVRPDHIILS        60
     SNRTTLFIRI QQIVWIRLTN                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page