(data stored in ACNUC7421 zone)

EMBL: CP002293.PE439

CP002293.PE439       Location/Qualifiers
FT   CDS             complement(500063..500962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0461"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: gtn:GTNG_2993 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73295"
FT                   /db_xref="GOA:A0A0F6BIP4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP4"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADP73295.1"
FT                   /translation="MIDIKQLKYFATIVEEGQITKAAKKLHMAQPPLSQQLKQLEETLG
FT                   ITLLERNGRKLELTAPGKILYKKAKQLLHQLEDAILEVREMEDGTSGVLSIGCVKSCFY
FT                   YLSEIIRPFHQLFPNVKFHLREGDSFSICELLRQREIDIGIVRLPIDSHHYEMIHLPND
FT                   PYIAVFPRQWNISKPYVYMKEFADIPLLLLHRIQGKGQYELVINECRRHGFEPKIICEC
FT                   PDATILLSLVSKGIGATIVPKSTVSFFCLPDICVLDIADSSIYAEAAAIIEKNRYIPKS
FT                   THHFLTILKEKFSNKIKN"
     MIDIKQLKYF ATIVEEGQIT KAAKKLHMAQ PPLSQQLKQL EETLGITLLE RNGRKLELTA        60
     PGKILYKKAK QLLHQLEDAI LEVREMEDGT SGVLSIGCVK SCFYYLSEII RPFHQLFPNV       120
     KFHLREGDSF SICELLRQRE IDIGIVRLPI DSHHYEMIHL PNDPYIAVFP RQWNISKPYV       180
     YMKEFADIPL LLLHRIQGKG QYELVINECR RHGFEPKIIC ECPDATILLS LVSKGIGATI       240
     VPKSTVSFFC LPDICVLDIA DSSIYAEAAA IIEKNRYIPK STHHFLTILK EKFSNKIKN        299
//

If you have problems or comments...

PBIL Back to PBIL home page