(data stored in SCRATCH zone)

EMBL: CP002293.PE440

CP002293.PE440       Location/Qualifiers
FT   CDS             501168..502643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0462"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase, oxygenase
FT                   subunit"
FT                   /note="KEGG: gtn:GTNG_2992
FT                   4-hydroxyphenylacetate-3-hydroxylase; TIGRFAM:
FT                   4-hydroxyphenylacetate 3-monooxygenase, oxygenase subunit;
FT                   PFAM: 4-hydroxyphenylacetate 3-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73296"
FT                   /db_xref="GOA:A0A0F6BIP5"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012687"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP5"
FT                   /inference="protein motif:TFAM:TIGR02309"
FT                   /protein_id="ADP73296.1"
FT                   /translation="MPAKTGKEYIERLKKAKSNVYIHGERVEDVTEHPAFKNVIQSMAR
FT                   LYDLQYEKQEKMLYTSPTTGNKVSITYIQPTTKEELIARREATQEWARTSAGMMGRSPD
FT                   YLNAEVMAMGVANDLFAEDDPMFAENARNYYEYARENDISLTHTLIHPQMNRSKAQHEQ
FT                   KDANVPLHLVEKRKDGIIVEGIRLLATQGGITDEILVFPSTVKKSGSGEDPYSLAFAIP
FT                   NNTPGVKFICREAFDYGKSHWDHPLGSRFEEGDAIVSFENVFVPWERVFICGNSSICNR
FT                   TFRETNAVVHMSHQVVAKNIVKTEFILGVVLCIMDAIGIEQFQHVKDKGTEIMLVLETM
FT                   RSHLYRAEHNAKLDKWGTMTPDFAALDAARNWYPRIYPRLAEIVRILGASGLMAIPAEA
FT                   DFNNEEIGAIVRRAMQGANIDGYERVQLFRLAWDMTMSAFGSRQTHYEYYFFGDPIRMG
FT                   MTYFDNYEKDYYKNLIYEFLGTPKLAHVSVNTH"
     MPAKTGKEYI ERLKKAKSNV YIHGERVEDV TEHPAFKNVI QSMARLYDLQ YEKQEKMLYT        60
     SPTTGNKVSI TYIQPTTKEE LIARREATQE WARTSAGMMG RSPDYLNAEV MAMGVANDLF       120
     AEDDPMFAEN ARNYYEYARE NDISLTHTLI HPQMNRSKAQ HEQKDANVPL HLVEKRKDGI       180
     IVEGIRLLAT QGGITDEILV FPSTVKKSGS GEDPYSLAFA IPNNTPGVKF ICREAFDYGK       240
     SHWDHPLGSR FEEGDAIVSF ENVFVPWERV FICGNSSICN RTFRETNAVV HMSHQVVAKN       300
     IVKTEFILGV VLCIMDAIGI EQFQHVKDKG TEIMLVLETM RSHLYRAEHN AKLDKWGTMT       360
     PDFAALDAAR NWYPRIYPRL AEIVRILGAS GLMAIPAEAD FNNEEIGAIV RRAMQGANID       420
     GYERVQLFRL AWDMTMSAFG SRQTHYEYYF FGDPIRMGMT YFDNYEKDYY KNLIYEFLGT       480
     PKLAHVSVNT H                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page