(data stored in SCRATCH zone)

EMBL: CP002293.PE444

CP002293.PE444       Location/Qualifiers
FT   CDS             505704..506519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0467"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase, HpaG1 subunit"
FT                   /note="KEGG: bcy:Bcer98_0971 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase, HpaG1
FT                   subunit; TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase, HpaG1 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73300"
FT                   /db_xref="GOA:A0A0F6BIP9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012686"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP9"
FT                   /inference="protein motif:TFAM:TIGR02305"
FT                   /protein_id="ADP73300.1"
FT                   /translation="MAKAVFKIAGISYMMESEVDPERNTVIIDGKEYSANQLQWEAPVS
FT                   GAIYGVLLNYKGEWEQFREQMTKPPYHHPPNAPILYMKPSNTVNVHGGCIPLPDDVPEL
FT                   QVGAALGVVIGQTATKVAKERAFDYISGYTIVNDVTIPHETIYRPAVKERARDGFTPVG
FT                   PWVVEKKDVDDPDLLDIRVFVNDRLVQHNNTKHLMRSVASLLADITEFMTLYPGDVLLV
FT                   GVPERAPLVKAGDYVRIEIEKIGRLENTVVHERDWIKETGSHETRAHSV"
     MAKAVFKIAG ISYMMESEVD PERNTVIIDG KEYSANQLQW EAPVSGAIYG VLLNYKGEWE        60
     QFREQMTKPP YHHPPNAPIL YMKPSNTVNV HGGCIPLPDD VPELQVGAAL GVVIGQTATK       120
     VAKERAFDYI SGYTIVNDVT IPHETIYRPA VKERARDGFT PVGPWVVEKK DVDDPDLLDI       180
     RVFVNDRLVQ HNNTKHLMRS VASLLADITE FMTLYPGDVL LVGVPERAPL VKAGDYVRIE       240
     IEKIGRLENT VVHERDWIKE TGSHETRAHS V                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page