(data stored in ACNUC7421 zone)

EMBL: CP002293.PE445

CP002293.PE445       Location/Qualifiers
FT   CDS             506494..507231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0468"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit"
FT                   /EC_number="5.3.3.10"
FT                   /note="TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase,HpaG2 subunit; KEGG:
FT                   bcy:Bcer98_0972 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase, HpaG2 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73301"
FT                   /db_xref="GOA:A0A0F6BIQ0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ0"
FT                   /inference="protein motif:TFAM:TIGR02303"
FT                   /protein_id="ADP73301.1"
FT                   /translation="MKRARIAFNGAVYEAVVEESGLLKLSNGRAVKEEEVTWLPPVEPR
FT                   TIFALGLNYAEHAQELSFSAPKEPLIFFKGRNTLIGHRGETPRPSDAAFMHYECELVVV
FT                   IGKMARKVKAEEAYEYVQGYTIANDYAIRDYLENYYRPNFRVKNRDGCTPIGPWLVDKE
FT                   DIDDPMNLTLRTYVNGKLVQEGNTKDMIFNIPALIEYLSSFMTLNAGDMILTGTPKGAV
FT                   NVNVGDEVVTEIEPIGRLMNKIV"
     MKRARIAFNG AVYEAVVEES GLLKLSNGRA VKEEEVTWLP PVEPRTIFAL GLNYAEHAQE        60
     LSFSAPKEPL IFFKGRNTLI GHRGETPRPS DAAFMHYECE LVVVIGKMAR KVKAEEAYEY       120
     VQGYTIANDY AIRDYLENYY RPNFRVKNRD GCTPIGPWLV DKEDIDDPMN LTLRTYVNGK       180
     LVQEGNTKDM IFNIPALIEY LSSFMTLNAG DMILTGTPKG AVNVNVGDEV VTEIEPIGRL       240
     MNKIV                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page