(data stored in ACNUC7421 zone)

EMBL: CP002293.PE446

CP002293.PE446       Location/Qualifiers
FT   CDS             507248..507634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0469"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /note="PFAM: 5-carboxymethyl-2-hydroxymuconate isomerase;
FT                   KEGG: gka:GK3029 5-carboxymethyl-2-hydroxymuconate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73302"
FT                   /db_xref="GOA:A0A0F6BIQ1"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ1"
FT                   /inference="protein motif:PFAM:PF02962"
FT                   /protein_id="ADP73302.1"
FT                   /translation="MPHFILEYTDNIAKEANIHELLRKVHQVLISRSDLFPIGGIRSRA
FT                   IELKEYYVADGTEDDAFVHGTLKIGAGRSEADKQAVCKEIFNVMKDHFSALYEKRYLAL
FT                   SLELYEFSESGTYKHNNIHRRYQE"
     MPHFILEYTD NIAKEANIHE LLRKVHQVLI SRSDLFPIGG IRSRAIELKE YYVADGTEDD        60
     AFVHGTLKIG AGRSEADKQA VCKEIFNVMK DHFSALYEKR YLALSLELYE FSESGTYKHN       120
     NIHRRYQE                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page