(data stored in ACNUC7421 zone)

EMBL: CP002293.PE447

CP002293.PE447       Location/Qualifiers
FT   CDS             507657..509171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0470"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /note="KEGG: gtn:GTNG_2986
FT                   5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase; TIGRFAM: 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73303"
FT                   /db_xref="GOA:A0A0F6BIQ2"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ2"
FT                   /inference="protein motif:TFAM:TIGR02299"
FT                   /protein_id="ADP73303.1"
FT                   /translation="MAGKIGNVLHYINGEFVEGASGNYFENVNPFTNEIINEVAEGWKE
FT                   DIDAAVRAAKEAFDNGPWRTMSVQERMTYILRIADLIEKYAEEISYLESLDTGLPISQT
FT                   KKQAARAAENFRFYAEMVKSRMVGEAYHVDGQFLNYTIYKPVGVAGLITPWNAPFMLET
FT                   WKVAPALATGNTVVLKPAEWSPLTANKLAEIIHEAGLPQGVFNVVHGFGETAGASLVAH
FT                   PNVRLISFTGETTTGSEIIKNSADTLKKTSMELGGKSPVIVFADADVEKALDAVVWGIF
FT                   SFNGERCTANSRLFLEKSIYDSFVEKLKERVNNISIGDPMDPATEVGPLIHRKHWETVM
FT                   NYIEIAKQEGAEVYSADVPEELKKGNFVPPTLLLNCHNSMKVAQEEIFGPVMAVMPFET
FT                   EEEVIRMANDVKYGLAAYVWTNDIKRGHRVAQSIESGMAWVNSQNVRDLRIPFGGTKYS
FT                   GIGREGGHYSFDFYTEVQVIHVSIGDHSIPKFGKIKQHSAASAQRG"
     MAGKIGNVLH YINGEFVEGA SGNYFENVNP FTNEIINEVA EGWKEDIDAA VRAAKEAFDN        60
     GPWRTMSVQE RMTYILRIAD LIEKYAEEIS YLESLDTGLP ISQTKKQAAR AAENFRFYAE       120
     MVKSRMVGEA YHVDGQFLNY TIYKPVGVAG LITPWNAPFM LETWKVAPAL ATGNTVVLKP       180
     AEWSPLTANK LAEIIHEAGL PQGVFNVVHG FGETAGASLV AHPNVRLISF TGETTTGSEI       240
     IKNSADTLKK TSMELGGKSP VIVFADADVE KALDAVVWGI FSFNGERCTA NSRLFLEKSI       300
     YDSFVEKLKE RVNNISIGDP MDPATEVGPL IHRKHWETVM NYIEIAKQEG AEVYSADVPE       360
     ELKKGNFVPP TLLLNCHNSM KVAQEEIFGP VMAVMPFETE EEVIRMANDV KYGLAAYVWT       420
     NDIKRGHRVA QSIESGMAWV NSQNVRDLRI PFGGTKYSGI GREGGHYSFD FYTEVQVIHV       480
     SIGDHSIPKF GKIKQHSAAS AQRG                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page