(data stored in ACNUC7421 zone)

EMBL: CP002293.PE448

CP002293.PE448       Location/Qualifiers
FT   CDS             509225..509869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0471"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: transcriptional regulator, GntR family; PFAM:
FT                   GntR domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH; GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73304"
FT                   /db_xref="GOA:A0A0F6BIQ3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADP73304.1"
FT                   /translation="MEPKTKNKTQIAYEYILSRIESGVYGPGYRIIIDQIARELSLSSI
FT                   PVREAIRQLEAEGWIQYKPYTGAIVSNINEKEYLETLSVLAVLEGYATALSSSNMKEGM
FT                   IQQLAELNKKMEQALHEFDFEQFSELNYEFHALIYKHCGNAYLEEQIKQIWQRMKRIRA
FT                   YGFTFVPQRARESIKEHEEIIRLLKEQAPRNEIEDFVRQHKLNTAEAFKNR"
     MEPKTKNKTQ IAYEYILSRI ESGVYGPGYR IIIDQIAREL SLSSIPVREA IRQLEAEGWI        60
     QYKPYTGAIV SNINEKEYLE TLSVLAVLEG YATALSSSNM KEGMIQQLAE LNKKMEQALH       120
     EFDFEQFSEL NYEFHALIYK HCGNAYLEEQ IKQIWQRMKR IRAYGFTFVP QRARESIKEH       180
     EEIIRLLKEQ APRNEIEDFV RQHKLNTAEA FKNR                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page