(data stored in ACNUC7421 zone)

EMBL: CP002293.PE449

CP002293.PE449       Location/Qualifiers
FT   CDS             510094..511263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0472"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gka:GK3026 branched amino acid ABC transporter
FT                   (substrate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73305"
FT                   /db_xref="GOA:A0A0F6BIQ4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ4"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADP73305.1"
FT                   /translation="MRRFLSAMISIFCVFILASCGKEPSNASKSEVIKIGGIFSASGGA
FT                   APLGKPEMGTVKMLVKELNENGGVNGKKIELIAYDDKSDQNEAVLSTKKLIEQEKVTAI
FT                   IGGTISGNSLAMIPQIEKAGIPYISLAASKQIVQPDDHSPRNWTFKTAQGDDIVISKLL
FT                   GYLKENGLQKVAWLNVANAYGTSGHEEFKRFAPDYGIKAVIEEEFEATVDDAKAMLTRV
FT                   KKANPQAIIVWGTAQESAVITKNIHQLGINVPVIESHGIGTKSFIDLAGEAAEGVIFPV
FT                   GRILVAEQLPDSDPQKETLLKYKKDFEKAYNYEPTTFGGHAWDAFHLLINAIKEAGTDK
FT                   EKIKEKLENTKNFVGISGIFNMDKNDHTGLAADSLVMVKIKDGKFVLAE"
     MRRFLSAMIS IFCVFILASC GKEPSNASKS EVIKIGGIFS ASGGAAPLGK PEMGTVKMLV        60
     KELNENGGVN GKKIELIAYD DKSDQNEAVL STKKLIEQEK VTAIIGGTIS GNSLAMIPQI       120
     EKAGIPYISL AASKQIVQPD DHSPRNWTFK TAQGDDIVIS KLLGYLKENG LQKVAWLNVA       180
     NAYGTSGHEE FKRFAPDYGI KAVIEEEFEA TVDDAKAMLT RVKKANPQAI IVWGTAQESA       240
     VITKNIHQLG INVPVIESHG IGTKSFIDLA GEAAEGVIFP VGRILVAEQL PDSDPQKETL       300
     LKYKKDFEKA YNYEPTTFGG HAWDAFHLLI NAIKEAGTDK EKIKEKLENT KNFVGISGIF       360
     NMDKNDHTGL AADSLVMVKI KDGKFVLAE                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page