(data stored in SCRATCH zone)

EMBL: CP002293.PE45

CP002293.PE45        Location/Qualifiers
FT   CDS             55466..55756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0045"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: SpoVG family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72901"
FT                   /db_xref="GOA:A0A0F6BHK0"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK0"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ADP72901.1"
FT                   /translation="MEVTDVRLRRVNTEGRMKAIASITLDNEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSATRGKIQEAILAEYHRLGKLEEELEEAGAS"
     MEVTDVRLRR VNTEGRMKAI ASITLDNEFV VHDIRVIDGN NGLFVAMPSK RTPDGEFRDI        60
     AHPINSATRG KIQEAILAEY HRLGKLEEEL EEAGAS                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page