(data stored in ACNUC7421 zone)

EMBL: CP002293.PE450

CP002293.PE450       Location/Qualifiers
FT   CDS             511342..512223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0473"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   gtn:GTNG_2983 branched chain amino acid ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73306"
FT                   /db_xref="GOA:A0A0F6BIQ5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADP73306.1"
FT                   /translation="MDIWNQFVQLLFSGLTVGSIYALVALGFVITYSITGILNLSQGDF
FT                   AMLGALICISFVNSGFPFIIAILLSIVLVMIIGGLFERSAIHPARYSSTATLIIITIGA
FT                   AFVFRGIAIFVWGTQPYALRPFTGNDSLQIFGAVIQTQNIWAIGISLVSLAVLYFFFNK
FT                   TYMGKAVTACVVNPFAARLMGIQPRKMSFGAIVISAGLGALAGIIIAPISGASYDMGVM
FT                   IGLKAFIAAVIGGLTNAPAAIAGAFIIGILEAFTEGYFSSGYKDAISFGLLLLVLFFMP
FT                   NGIFAKASGKRV"
     MDIWNQFVQL LFSGLTVGSI YALVALGFVI TYSITGILNL SQGDFAMLGA LICISFVNSG        60
     FPFIIAILLS IVLVMIIGGL FERSAIHPAR YSSTATLIII TIGAAFVFRG IAIFVWGTQP       120
     YALRPFTGND SLQIFGAVIQ TQNIWAIGIS LVSLAVLYFF FNKTYMGKAV TACVVNPFAA       180
     RLMGIQPRKM SFGAIVISAG LGALAGIIIA PISGASYDMG VMIGLKAFIA AVIGGLTNAP       240
     AAIAGAFIIG ILEAFTEGYF SSGYKDAISF GLLLLVLFFM PNGIFAKASG KRV              293
//

If you have problems or comments...

PBIL Back to PBIL home page