(data stored in SCRATCH zone)

EMBL: CP002293.PE453

CP002293.PE453       Location/Qualifiers
FT   CDS             514074..514820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0476"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gtn:GTNG_2980 branched-chain amino acid ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73309"
FT                   /db_xref="GOA:A0A0F6BIQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73309.1"
FT                   /translation="MLTLNHLHVYHGHLHVLKGIHLQIGKGEIMAIVGANGAGKSTLLG
FT                   TIAGIYLPKEGEMIFENEVLPYGKVEQIVKKGICLVPERRQIFDDLSVKDNLLLGAYHR
FT                   YRHDFRQVMRDYENVLDVFPKLKTMLDRPGGLLSGGEQQMLAIGRGLMAKPALMMLDEP
FT                   SLGLAPLIVKEIMKLLEQLRDQFGMTILLIEQNVRAALQIADYACVLDRGEIVIQGKAD
FT                   ELLRDERVKNAYLGIQRKTLENTKHR"
     MLTLNHLHVY HGHLHVLKGI HLQIGKGEIM AIVGANGAGK STLLGTIAGI YLPKEGEMIF        60
     ENEVLPYGKV EQIVKKGICL VPERRQIFDD LSVKDNLLLG AYHRYRHDFR QVMRDYENVL       120
     DVFPKLKTML DRPGGLLSGG EQQMLAIGRG LMAKPALMML DEPSLGLAPL IVKEIMKLLE       180
     QLRDQFGMTI LLIEQNVRAA LQIADYACVL DRGEIVIQGK ADELLRDERV KNAYLGIQRK       240
     TLENTKHR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page