(data stored in ACNUC7421 zone)

EMBL: CP002293.PE454

CP002293.PE454       Location/Qualifiers
FT   CDS             complement(514938..515504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0477"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gka:GK3020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73310"
FT                   /db_xref="GOA:A0A0F6BIQ9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ9"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73310.1"
FT                   /translation="MYDIAIIGAGPAGASAAIFTAKAGKKTVLIDNDKSITKRAWIENH
FT                   YGVVETTGPDLVETGKKQAAKFGAELVVGQATNIEKTENGFRIQTDNGTFEAKHVILAT
FT                   GIAVDLAEKIGVKTRQGTEPRIKTVIDADADGRTNIEGIWAAGTVAGVSVHTIITAGDG
FT                   AKVAINVISELNGERYVDHDVLQSK"
     MYDIAIIGAG PAGASAAIFT AKAGKKTVLI DNDKSITKRA WIENHYGVVE TTGPDLVETG        60
     KKQAAKFGAE LVVGQATNIE KTENGFRIQT DNGTFEAKHV ILATGIAVDL AEKIGVKTRQ       120
     GTEPRIKTVI DADADGRTNI EGIWAAGTVA GVSVHTIITA GDGAKVAINV ISELNGERYV       180
     DHDVLQSK                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page