(data stored in ACNUC7421 zone)

EMBL: CP002293.PE457

CP002293.PE457       Location/Qualifiers
FT   CDS             517844..518602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0480"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gtn:GTNG_1274 ferrichrome ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73313"
FT                   /db_xref="GOA:A0A0F6BIR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73313.1"
FT                   /translation="MVEVRGVYKQYGGKNVVDNVSITIPTGKLTSLIGPNGAGKSTLLS
FT                   IMSRLIDKDRGEVRIEGKEISQYKSDELAKKISILKQSNHIAIRLTVKELVSFGRFPYS
FT                   RGRLTREDWEYVKEAIRYMELEDLQDCYLNELSGGQRQRAYIAMVLAQDTDYIFLDEPL
FT                   NNLDMKHCVQMMKVLRKLVDELGKTIVVVMHDINFASCYSDYIVALKNGKVVREGTASE
FT                   IMSNGVLQGIYDMDVHIETIHDKKICVYFA"
     MVEVRGVYKQ YGGKNVVDNV SITIPTGKLT SLIGPNGAGK STLLSIMSRL IDKDRGEVRI        60
     EGKEISQYKS DELAKKISIL KQSNHIAIRL TVKELVSFGR FPYSRGRLTR EDWEYVKEAI       120
     RYMELEDLQD CYLNELSGGQ RQRAYIAMVL AQDTDYIFLD EPLNNLDMKH CVQMMKVLRK       180
     LVDELGKTIV VVMHDINFAS CYSDYIVALK NGKVVREGTA SEIMSNGVLQ GIYDMDVHIE       240
     TIHDKKICVY FA                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page