(data stored in ACNUC7421 zone)

EMBL: CP002293.PE46

CP002293.PE46        Location/Qualifiers
FT   CDS             55887..57266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0046"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="KEGG: gwc:GWCH70_0045 UDP-N-acetylglucosamine
FT                   pyrophosphorylase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72902"
FT                   /db_xref="GOA:A0A0F6BHK1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK1"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ADP72902.1"
FT                   /translation="MVKRYAVILAAGQGTRMKSKQYKVLHPVCGKPMVQHVVDQVLQLG
FT                   IEKLITVVGFGAEQVKMQLGDQSEYAFQQEQLGTAHAVMQAASHLHGKDGVTLVVCGDT
FT                   PLITAETMQALLDHHLATKAKATVLTAIADNPAGYGRIVRDSHGNVAKIVEHKDASEQE
FT                   RAIKEINTGTYCFDNKSLFEALTHVSNNNVQGEYYLTDVIEILKSNGGIISAYEAPSFE
FT                   ETIGVNDRAALAEAEKIMRARICRKHMLNGVTIIDPAHTYISAEAQIGRDTVIYPGTVI
FT                   EGKTVIGEDCIIGPNSEIKDCLIGNGTTIRHSVAHDSEIGNDVTIGPFAHIRPLSKIAD
FT                   EVRIGNFVEVKKSVFGKGSKASHLSYIGDAEIGADVNLGCGSITVNYDGKNKHMTKIED
FT                   GAFIGCNVNLIAPVTVGKGAYVAAGSTITDDVPANALSIARARQVNKENYVDRLSIKKN
FT                   S"
     MVKRYAVILA AGQGTRMKSK QYKVLHPVCG KPMVQHVVDQ VLQLGIEKLI TVVGFGAEQV        60
     KMQLGDQSEY AFQQEQLGTA HAVMQAASHL HGKDGVTLVV CGDTPLITAE TMQALLDHHL       120
     ATKAKATVLT AIADNPAGYG RIVRDSHGNV AKIVEHKDAS EQERAIKEIN TGTYCFDNKS       180
     LFEALTHVSN NNVQGEYYLT DVIEILKSNG GIISAYEAPS FEETIGVNDR AALAEAEKIM       240
     RARICRKHML NGVTIIDPAH TYISAEAQIG RDTVIYPGTV IEGKTVIGED CIIGPNSEIK       300
     DCLIGNGTTI RHSVAHDSEI GNDVTIGPFA HIRPLSKIAD EVRIGNFVEV KKSVFGKGSK       360
     ASHLSYIGDA EIGADVNLGC GSITVNYDGK NKHMTKIEDG AFIGCNVNLI APVTVGKGAY       420
     VAAGSTITDD VPANALSIAR ARQVNKENYV DRLSIKKNS                              459
//

If you have problems or comments...

PBIL Back to PBIL home page