(data stored in ACNUC7421 zone)

EMBL: CP002293.PE460

CP002293.PE460       Location/Qualifiers
FT   CDS             520486..521205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0483"
FT                   /product="dethiobiotin synthase"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG:
FT                   gwc:GWCH70_2946 dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73316"
FT                   /db_xref="GOA:A0A0F6BIR5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR5"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADP73316.1"
FT                   /translation="MGKAIFITGTGTEIGKTVATSFLTFVFQTLGLRTKIFKPVQTGLA
FT                   EDGVSFADQHWYEKVVELPQSEGLYYMEPAVSPHLAATLTNTTIDPALIAEKIEQWKRQ
FT                   YDIVLVEGAGGLAVPLIEKEQGFYMTNDLIRECNIPIIIVSLSGLGAIHHTVTTASYAQ
FT                   QQGIQVLGLIFNQFDPESIIHANNVQTIQKILKFPVIATLPSLADVSKHAMMALAERWL
FT                   EGNKQKQLLREVLSVEV"
     MGKAIFITGT GTEIGKTVAT SFLTFVFQTL GLRTKIFKPV QTGLAEDGVS FADQHWYEKV        60
     VELPQSEGLY YMEPAVSPHL AATLTNTTID PALIAEKIEQ WKRQYDIVLV EGAGGLAVPL       120
     IEKEQGFYMT NDLIRECNIP IIIVSLSGLG AIHHTVTTAS YAQQQGIQVL GLIFNQFDPE       180
     SIIHANNVQT IQKILKFPVI ATLPSLADVS KHAMMALAER WLEGNKQKQL LREVLSVEV        239
//

If you have problems or comments...

PBIL Back to PBIL home page