(data stored in ACNUC7421 zone)

EMBL: CP002293.PE466

CP002293.PE466       Location/Qualifiers
FT   CDS             complement(525417..525680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS1"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2940"
FT                   /protein_id="ADP73322.1"
FT                   /translation="MQQQMNTQQPSAMPQPPQIISTKDALYFTDMLSWNLLAMKKAHFF
FT                   ASQCQDKEVSAAIEKAGQMHQRHYQQILSHLQNTGRPKTPMQ"
     MQQQMNTQQP SAMPQPPQII STKDALYFTD MLSWNLLAMK KAHFFASQCQ DKEVSAAIEK        60
     AGQMHQRHYQ QILSHLQNTG RPKTPMQ                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page