(data stored in SCRATCH zone)

EMBL: CP002293.PE479

CP002293.PE479       Location/Qualifiers
FT   CDS             539054..539722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0503"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gwc:GWCH70_2925
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73335"
FT                   /db_xref="GOA:A0A0F6BIT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73335.1"
FT                   /translation="MLANLLPNVEWDMMWAATVETLYMTGIAVAVTFILGTILGLLLFL
FT                   TSKGNLWENRLANMIIAAAVNIFRSIPFIILIILLIPLTKWLVGTMLGANAALPALIIG
FT                   AAPFYARMVEIALREIDKGVIEAAKAMGASTATIIWKVLLPESLPALVSGITVTAIALV
FT                   GYTAMAGVVGAGGLGNLAYLEGFQRSHNDVTFVATVLVLIIVFVIQFIGDFVTSKIDKR
FT                   "
     MLANLLPNVE WDMMWAATVE TLYMTGIAVA VTFILGTILG LLLFLTSKGN LWENRLANMI        60
     IAAAVNIFRS IPFIILIILL IPLTKWLVGT MLGANAALPA LIIGAAPFYA RMVEIALREI       120
     DKGVIEAAKA MGASTATIIW KVLLPESLPA LVSGITVTAI ALVGYTAMAG VVGAGGLGNL       180
     AYLEGFQRSH NDVTFVATVL VLIIVFVIQF IGDFVTSKID KR                          222
//

If you have problems or comments...

PBIL Back to PBIL home page