(data stored in ACNUC7421 zone)

EMBL: CP002293.PE480

CP002293.PE480       Location/Qualifiers
FT   CDS             539739..540578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0504"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: gwc:GWCH70_2924 NlpA
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73336"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT5"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADP73336.1"
FT                   /translation="MKKWLSALFAVVLVLALAACGGNNNASDGQEKGKLTKLVVGASNV
FT                   PHAEILEKAKPILKEKGIDLEIVKFQDYILPNKALADKEIDANYFQHIPYLESQKKEHG
FT                   YDFVNAGGIHIEPIGIYSKKYKSLDELPDGATIIMSNSVADHGRILSMLQEKGLIKLKD
FT                   GVDKTKATVKDIVENPKHLKFEADVDAGMLPQIYKNGEGDAVLINANYALDAGLDPAKD
FT                   PIAVESPKDNPYVNIIAVRKGDENRKEIKTLVEVLQSKEIQDFIKKEYKGAVIPAAQ"
     MKKWLSALFA VVLVLALAAC GGNNNASDGQ EKGKLTKLVV GASNVPHAEI LEKAKPILKE        60
     KGIDLEIVKF QDYILPNKAL ADKEIDANYF QHIPYLESQK KEHGYDFVNA GGIHIEPIGI       120
     YSKKYKSLDE LPDGATIIMS NSVADHGRIL SMLQEKGLIK LKDGVDKTKA TVKDIVENPK       180
     HLKFEADVDA GMLPQIYKNG EGDAVLINAN YALDAGLDPA KDPIAVESPK DNPYVNIIAV       240
     RKGDENRKEI KTLVEVLQSK EIQDFIKKEY KGAVIPAAQ                              279
//

If you have problems or comments...

PBIL Back to PBIL home page