(data stored in ACNUC7421 zone)

EMBL: CP002293.PE481

CP002293.PE481       Location/Qualifiers
FT   CDS             541092..541307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73337"
FT                   /db_xref="GOA:A0A0F6BIT6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73337.1"
FT                   /translation="MLAVSETVASAKKCLHERMPEHEMKASLSGSFFVIFIDMLDKKFF
FT                   HYVYSDILYKRLLILFICYKIVMRIK"
     MLAVSETVAS AKKCLHERMP EHEMKASLSG SFFVIFIDML DKKFFHYVYS DILYKRLLIL        60
     FICYKIVMRI K                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page