(data stored in ACNUC7421 zone)

EMBL: CP002293.PE483

CP002293.PE483       Location/Qualifiers
FT   CDS             542169..543482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0507"
FT                   /product="FeS assembly protein SufD"
FT                   /note="KEGG: gwc:GWCH70_2922 FeS assembly protein SufD;
FT                   TIGRFAM: FeS assembly protein SufD; PFAM: SufBD protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73339"
FT                   /db_xref="GOA:A0A0F6BIT8"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT8"
FT                   /inference="protein motif:TFAM:TIGR01981"
FT                   /protein_id="ADP73339.1"
FT                   /translation="MTTETKIPFDQQYVRSFSGGRGEPDWLLQLRLQALAKAEELPLPK
FT                   PDKTKIDNWNFTQFANHIVERAPFASLDELPETVKALIEAGEGTKNLYVQRDHTPAFLA
FT                   LSEDLKAKGVIFTDIFTAAREHGDLLQKYLLKDGVKIDEHRLTALHAALFNGGVFVYVP
FT                   KGVEVDVPLQAVYIQESDDTALFNHVIVVAEDNSRVVYVENYISAKETSKAVVNIVAEV
FT                   FANTNARVFFAAVDNLAKGVTTYVNRRGIAGRDGRIEWALGLMNDGDTISENITRLIGD
FT                   GSFGDTKTVVVGRGEQVQNFTTSVVHYGKHTEGYILKHGVVRDSATSIFNGIGKIEHGA
FT                   SKSNAQQESRVLMLSEKARGDANPILLIDEDDVMAGHAASVGRVDPTQLYYLMSRGIPK
FT                   REAERLIIHGFLAPVVEAIPIESVKKQLIEVIERKVQS"
     MTTETKIPFD QQYVRSFSGG RGEPDWLLQL RLQALAKAEE LPLPKPDKTK IDNWNFTQFA        60
     NHIVERAPFA SLDELPETVK ALIEAGEGTK NLYVQRDHTP AFLALSEDLK AKGVIFTDIF       120
     TAAREHGDLL QKYLLKDGVK IDEHRLTALH AALFNGGVFV YVPKGVEVDV PLQAVYIQES       180
     DDTALFNHVI VVAEDNSRVV YVENYISAKE TSKAVVNIVA EVFANTNARV FFAAVDNLAK       240
     GVTTYVNRRG IAGRDGRIEW ALGLMNDGDT ISENITRLIG DGSFGDTKTV VVGRGEQVQN       300
     FTTSVVHYGK HTEGYILKHG VVRDSATSIF NGIGKIEHGA SKSNAQQESR VLMLSEKARG       360
     DANPILLIDE DDVMAGHAAS VGRVDPTQLY YLMSRGIPKR EAERLIIHGF LAPVVEAIPI       420
     ESVKKQLIEV IERKVQS                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page