(data stored in ACNUC7421 zone)

EMBL: CP002293.PE487

CP002293.PE487       Location/Qualifiers
FT   CDS             547039..547887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0511"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   gwc:GWCH70_2914 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73343"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU2"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADP73343.1"
FT                   /translation="MIYIGLTGWGDHDSLYPPGLAAKDKLQEYAAHFPTVEVDSYFYAI
FT                   QPRQNVEKWIRETPDSFRFVVKAYQGMTGHERGPIPYSSKEEMFAAFLDSIEPFIRSGK
FT                   LAMVLFQFPPWFDCRREHVTYLRWCKAQMKEVPVALEFRHRSWFSPRFYAKTLQFMTEE
FT                   GWIHSICDEPQAGEGSIPTVLHPTNAEKTLVRLHGRNVYGWNKATSGENWRAVRYLYRY
FT                   REDELREWVAHIETLKTKTNDIYVLFNNNSGGDAADNAKQFIRLLGIEYTDLAPRQLDL
FT                   F"
     MIYIGLTGWG DHDSLYPPGL AAKDKLQEYA AHFPTVEVDS YFYAIQPRQN VEKWIRETPD        60
     SFRFVVKAYQ GMTGHERGPI PYSSKEEMFA AFLDSIEPFI RSGKLAMVLF QFPPWFDCRR       120
     EHVTYLRWCK AQMKEVPVAL EFRHRSWFSP RFYAKTLQFM TEEGWIHSIC DEPQAGEGSI       180
     PTVLHPTNAE KTLVRLHGRN VYGWNKATSG ENWRAVRYLY RYREDELREW VAHIETLKTK       240
     TNDIYVLFNN NSGGDAADNA KQFIRLLGIE YTDLAPRQLD LF                          282
//

If you have problems or comments...

PBIL Back to PBIL home page