(data stored in ACNUC7421 zone)

EMBL: CP002293.PE488

CP002293.PE488       Location/Qualifiers
FT   CDS             547904..548725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0512"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   gwc:GWCH70_2913 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73344"
FT                   /db_xref="GOA:A0A0F6BIU3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU3"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADP73344.1"
FT                   /translation="MGDVLLLVIVGFLAGTVGSLVGLGGGVIIVPSLLFLGAIHWLPHV
FT                   TPQVAVGTSLVVIIFNGLSSTLSYMKEKMVDYRSGLLFFIGSGPGAIIGAWMNNKLSLE
FT                   HFSLYFGLFLIAVSFFLSFSSNASARSQRKPFKITRTYITNEGETVTYGYHPLAAIAIS
FT                   FVVGFFGGMFGIGGGSLMVPAMIILFFFPPHVAVATSMFMIFLSSLVSSLTHVFMGNVQ
FT                   WLFALSLIPGVWFGAKTGAFINKRLRSKTIVIALRLVLVLLGIRLIYQSFS"
     MGDVLLLVIV GFLAGTVGSL VGLGGGVIIV PSLLFLGAIH WLPHVTPQVA VGTSLVVIIF        60
     NGLSSTLSYM KEKMVDYRSG LLFFIGSGPG AIIGAWMNNK LSLEHFSLYF GLFLIAVSFF       120
     LSFSSNASAR SQRKPFKITR TYITNEGETV TYGYHPLAAI AISFVVGFFG GMFGIGGGSL       180
     MVPAMIILFF FPPHVAVATS MFMIFLSSLV SSLTHVFMGN VQWLFALSLI PGVWFGAKTG       240
     AFINKRLRSK TIVIALRLVL VLLGIRLIYQ SFS                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page