(data stored in ACNUC7421 zone)

EMBL: CP002293.PE489

CP002293.PE489       Location/Qualifiers
FT   CDS             548743..550134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0513"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase
FT                   domain-containing protein; KEGG: gwc:GWCH70_2912
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73345"
FT                   /db_xref="GOA:A0A0F6BIU4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR011240"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU4"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADP73345.1"
FT                   /translation="MKRTIYVYHTNDVHSHFEYWPKISHFLWEQRQKHEKRNETMLLFD
FT                   IGDFIDRFHPITEATRGKANVDLLNELHYDAVTIGNNEGITLDYNELDTLYENARFPVL
FT                   VANLFKKDGTRPSWAHPYCIIPVSDTFRVGVIGATAYFTKSYELLGWKVATPFEILGDI
FT                   AAEVKKQADLVILLSHLGINDDEKIAQTIPEIDIILGGHTHHLFPEGKRVHDTLLCAAG
FT                   KYGKFVGIVKLEIEESDHTYEALATVVDVEGFPDSEKMRRTLALLEKQSLQKLESEQVA
FT                   ELKEDLPLQWFSPSPLAKLLASALREWCEAEIGMVNAGVLLEPLYKGTVTRKDLHRICP
FT                   HPINPCKVQLRGAELKEIILQANTERMKYLEFKGFGFRGKVMGQMVYDGVELEMETGKD
FT                   GYEHIRRITINGEPLNPDQLYDVATIDMFAIGHFYPQIQRAPKKEYYMPEFLRDVLAWK
FT                   LADRK"
     MKRTIYVYHT NDVHSHFEYW PKISHFLWEQ RQKHEKRNET MLLFDIGDFI DRFHPITEAT        60
     RGKANVDLLN ELHYDAVTIG NNEGITLDYN ELDTLYENAR FPVLVANLFK KDGTRPSWAH       120
     PYCIIPVSDT FRVGVIGATA YFTKSYELLG WKVATPFEIL GDIAAEVKKQ ADLVILLSHL       180
     GINDDEKIAQ TIPEIDIILG GHTHHLFPEG KRVHDTLLCA AGKYGKFVGI VKLEIEESDH       240
     TYEALATVVD VEGFPDSEKM RRTLALLEKQ SLQKLESEQV AELKEDLPLQ WFSPSPLAKL       300
     LASALREWCE AEIGMVNAGV LLEPLYKGTV TRKDLHRICP HPINPCKVQL RGAELKEIIL       360
     QANTERMKYL EFKGFGFRGK VMGQMVYDGV ELEMETGKDG YEHIRRITIN GEPLNPDQLY       420
     DVATIDMFAI GHFYPQIQRA PKKEYYMPEF LRDVLAWKLA DRK                         463
//

If you have problems or comments...

PBIL Back to PBIL home page