(data stored in ACNUC7421 zone)

EMBL: CP002293.PE491

CP002293.PE491       Location/Qualifiers
FT   CDS             550564..551310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0515"
FT                   /product="sporulation protein YunB"
FT                   /note="KEGG: gwc:GWCH70_2910 sporulation protein YunB;
FT                   TIGRFAM: sporulation protein YunB; PFAM: Sporulation
FT                   protein YunB-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73347"
FT                   /db_xref="GOA:A0A0F6BIU6"
FT                   /db_xref="InterPro:IPR014197"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU6"
FT                   /inference="protein motif:TFAM:TIGR02832"
FT                   /protein_id="ADP73347.1"
FT                   /translation="MPRFPARLRKGPLPLRYVFLLTFVFFMFATAVSLWIVNKAIEPVL
FT                   MEIAEKETKRIANLVINNAIEQQFLKENTEMSDLITVQKDESGKIASVDFNTAVVNRIL
FT                   AKTDDYVMQSLKAATEGKIAELEFPDDKSEKEKNNGIIYYIPIGQVTDNALLGNLGPRV
FT                   PVQFQLIGNVTSDVTKEIKPFGINNALIEVDIHVSVDIQVVIPFATKAATVSTDIPIAM
FT                   QVIQGEVPEFYNDGGNVNPSFKVPSQ"
     MPRFPARLRK GPLPLRYVFL LTFVFFMFAT AVSLWIVNKA IEPVLMEIAE KETKRIANLV        60
     INNAIEQQFL KENTEMSDLI TVQKDESGKI ASVDFNTAVV NRILAKTDDY VMQSLKAATE       120
     GKIAELEFPD DKSEKEKNNG IIYYIPIGQV TDNALLGNLG PRVPVQFQLI GNVTSDVTKE       180
     IKPFGINNAL IEVDIHVSVD IQVVIPFATK AATVSTDIPI AMQVIQGEVP EFYNDGGNVN       240
     PSFKVPSQ                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page