(data stored in SCRATCH zone)

EMBL: CP002293.PE492

CP002293.PE492       Location/Qualifiers
FT   CDS             551666..553180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0516"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   gwc:GWCH70_2909 sodium:neurotransmitter symporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73348"
FT                   /db_xref="GOA:A0A0F6BIU7"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU7"
FT                   /inference="protein motif:PFAM:PF00209"
FT                   /protein_id="ADP73348.1"
FT                   /translation="MENRQQWGSRAGFILAAAGSAIGLGNIWRFPGVAYENGGGAFFFP
FT                   YLFALLTAGIPLLVMEFTIGHKYRGSAPLSFSRIHKNLEWIGWWQVLISFVISTYYAVI
FT                   IAWALSYTVFSFNLKWGEDTEGFLFKNYLHLVDKPGQLGGISFNVFIPLLIVWLVSLGV
FT                   LYKGVKKGIELANKIFLPTLVVLFLIIVLRAITLDGAVEGLNVFFKPNWDQIMSGKVWI
FT                   AAYSQIFFSLSIAFAIMVTYSSYLPKNSDITNNAFITGFANSGFELLAGIGVFSALGFL
FT                   AQQQGVPVDKVVSSGVGLAFVVFPKIISEFPAFNAFFGVLFFLSLALAGLTSLISICET
FT                   YIAGIQEKFGISRAKSVLFGGGLAALLSLFFASHGGLYLLDVVDYFINNFGVALAGFVE
FT                   VVVIAWIVRELSNLQQHANSVSDIMLGAWWKICLSVITPLVLGYMMVDNIRTNIKENYE
FT                   GYATWFVTSFGWIVALAVIVIGILFSFKQWHGSAVGEAGHTERRGG"
     MENRQQWGSR AGFILAAAGS AIGLGNIWRF PGVAYENGGG AFFFPYLFAL LTAGIPLLVM        60
     EFTIGHKYRG SAPLSFSRIH KNLEWIGWWQ VLISFVISTY YAVIIAWALS YTVFSFNLKW       120
     GEDTEGFLFK NYLHLVDKPG QLGGISFNVF IPLLIVWLVS LGVLYKGVKK GIELANKIFL       180
     PTLVVLFLII VLRAITLDGA VEGLNVFFKP NWDQIMSGKV WIAAYSQIFF SLSIAFAIMV       240
     TYSSYLPKNS DITNNAFITG FANSGFELLA GIGVFSALGF LAQQQGVPVD KVVSSGVGLA       300
     FVVFPKIISE FPAFNAFFGV LFFLSLALAG LTSLISICET YIAGIQEKFG ISRAKSVLFG       360
     GGLAALLSLF FASHGGLYLL DVVDYFINNF GVALAGFVEV VVIAWIVREL SNLQQHANSV       420
     SDIMLGAWWK ICLSVITPLV LGYMMVDNIR TNIKENYEGY ATWFVTSFGW IVALAVIVIG       480
     ILFSFKQWHG SAVGEAGHTE RRGG                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page