(data stored in SCRATCH zone)

EMBL: CP002293.PE494

CP002293.PE494       Location/Qualifiers
FT   CDS             complement(553304..554308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0518"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: gwc:GWCH70_2907 peptidase
FT                   M23"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73350"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU9"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADP73350.1"
FT                   /translation="MHPFIIAIVTTAVIFLSPKPIFAQEKSDEAIYQKRMELYKKAEAV
FT                   SLIPWYYFAAIDQYERNVRQVRRDLPKPTGALGIYIKPEIWAGPLNKNPYDTNPFSISQ
FT                   FGGFGMDGNGDGVADPKNDEDVIFAMARFLQSYGIDHKRIKMALWDYYQRSKTVDLILG
FT                   KVKIYKKYHTLKLDGHVFPLPLHTDYSYRDTWGDARGWGGRRIHEGTDIFANYGVPVRS
FT                   TCYGIVELKGWNKYGGWRIGIRDINNNYHYFAHLNGFPPHLREGQIVEPGTIIGYVGSS
FT                   GYGPPGTAGKFPPHLHYGMYKDNGYMEWSFDPYPHLKAWERAEWLKKKQGGSH"
     MHPFIIAIVT TAVIFLSPKP IFAQEKSDEA IYQKRMELYK KAEAVSLIPW YYFAAIDQYE        60
     RNVRQVRRDL PKPTGALGIY IKPEIWAGPL NKNPYDTNPF SISQFGGFGM DGNGDGVADP       120
     KNDEDVIFAM ARFLQSYGID HKRIKMALWD YYQRSKTVDL ILGKVKIYKK YHTLKLDGHV       180
     FPLPLHTDYS YRDTWGDARG WGGRRIHEGT DIFANYGVPV RSTCYGIVEL KGWNKYGGWR       240
     IGIRDINNNY HYFAHLNGFP PHLREGQIVE PGTIIGYVGS SGYGPPGTAG KFPPHLHYGM       300
     YKDNGYMEWS FDPYPHLKAW ERAEWLKKKQ GGSH                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page