(data stored in ACNUC7421 zone)

EMBL: CP002293.PE496

CP002293.PE496       Location/Qualifiers
FT   CDS             complement(555430..556113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0520"
FT                   /product="Sporulation lipoprotein YhcN/YlaJ-like protein"
FT                   /note="PFAM: Sporulation lipoprotein YhcN/YlaJ-like; KEGG:
FT                   gwc:GWCH70_2905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73352"
FT                   /db_xref="InterPro:IPR019076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV1"
FT                   /inference="protein motif:PFAM:PF09580"
FT                   /protein_id="ADP73352.1"
FT                   /translation="MRKALLAVTLSAATLAGCAQTAQDNNTDVYKRSGNTINVTDRNDL
FT                   YNENGVPNGDDTRMDNFGYVRHQKSPVPSDANLYNNMPTFNRERAADLISKLCTQLPNV
FT                   NDAATLVTDEEVLIVYDTDTKNRHQTADQVKKTALSVVPRYYHVYVADDPRLMKDIERF
FT                   GRLDSNSRNIDQIIDTTIQRMLKYPQGRKLSDGENENGEMIHETNDRLDRDFHDERPAP
FT                   AKTSR"
     MRKALLAVTL SAATLAGCAQ TAQDNNTDVY KRSGNTINVT DRNDLYNENG VPNGDDTRMD        60
     NFGYVRHQKS PVPSDANLYN NMPTFNRERA ADLISKLCTQ LPNVNDAATL VTDEEVLIVY       120
     DTDTKNRHQT ADQVKKTALS VVPRYYHVYV ADDPRLMKDI ERFGRLDSNS RNIDQIIDTT       180
     IQRMLKYPQG RKLSDGENEN GEMIHETNDR LDRDFHDERP APAKTSR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page