(data stored in ACNUC7421 zone)

EMBL: CP002293.PE5

CP002293.PE5         Location/Qualifiers
FT   CDS             4593..6515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: gwc:GWCH70_0005 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72861"
FT                   /db_xref="GOA:A0A0F6BHG0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG0"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADP72861.1"
FT                   /translation="MTMEQKVEHTYDASQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLV
FT                   WEIVDNSIDEALAGYCTEINVTIEKDGSITVTDNGRGIPVDIQEKMGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSEELEVYVHRDGKIHYQKYQRGVPCTDLQVVG
FT                   ETDRTGTTVHFKPDPEIFTETTEFDYETLATRLRELAFLNRGLKITLEDKRVENRKNEY
FT                   CYEGGIQSYVKHLNRTREVLHEEPIYIIGERDGIYVEIAFQYNDSYSSNIYSFVNNIHT
FT                   HEGGTHESGFKMALTRIINDYARKQQIFKDNDPNLTGEDVREGLTAIVSIKHPAPQFEG
FT                   QTKTKLGNSDARTVTDAVFSEQFETFLLENPTIARKIVEKGMMAARARLAAKKARELTR
FT                   RKSALEISNLPGKLADCSSKDPSISELYVVEGDSAGGSAKQGRDRHFQAILPLRGKIIN
FT                   VEKARLDKILSNNEVRAIITALGTGIGEDFDITKARYHKIIIMTDADVDGAHIRTLLLT
FT                   FFYRYMREFIERGYVYIAQPPLYKIEQDKQVRYAYNDRQLEKILAELPENPKPTIQRYK
FT                   GLGEMNPEQLWETTMNPETRTLLQVSLQDAIEADETFEILMGDKVEPRRQFIEENARYV
FT                   KNLDI"
     MTMEQKVEHT YDASQIQVLE GLEAVRKRPG MYIGSTGPKG LHHLVWEIVD NSIDEALAGY        60
     CTEINVTIEK DGSITVTDNG RGIPVDIQEK MGRPAVEVIM TVLHAGGKFG GGGYKVSGGL       120
     HGVGASVVNA LSEELEVYVH RDGKIHYQKY QRGVPCTDLQ VVGETDRTGT TVHFKPDPEI       180
     FTETTEFDYE TLATRLRELA FLNRGLKITL EDKRVENRKN EYCYEGGIQS YVKHLNRTRE       240
     VLHEEPIYII GERDGIYVEI AFQYNDSYSS NIYSFVNNIH THEGGTHESG FKMALTRIIN       300
     DYARKQQIFK DNDPNLTGED VREGLTAIVS IKHPAPQFEG QTKTKLGNSD ARTVTDAVFS       360
     EQFETFLLEN PTIARKIVEK GMMAARARLA AKKARELTRR KSALEISNLP GKLADCSSKD       420
     PSISELYVVE GDSAGGSAKQ GRDRHFQAIL PLRGKIINVE KARLDKILSN NEVRAIITAL       480
     GTGIGEDFDI TKARYHKIII MTDADVDGAH IRTLLLTFFY RYMREFIERG YVYIAQPPLY       540
     KIEQDKQVRY AYNDRQLEKI LAELPENPKP TIQRYKGLGE MNPEQLWETT MNPETRTLLQ       600
     VSLQDAIEAD ETFEILMGDK VEPRRQFIEE NARYVKNLDI                             640
//

If you have problems or comments...

PBIL Back to PBIL home page