(data stored in SCRATCH zone)

EMBL: CP002293.PE501

CP002293.PE501       Location/Qualifiers
FT   CDS             557907..558680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0525"
FT                   /product="HAD-superfamily subfamily IIA hydrolase like
FT                   protein"
FT                   /note="KEGG: gwc:GWCH70_2900 HAD-superfamily subfamily IIA
FT                   hydrolase like protein; TIGRFAM: HAD-superfamily subfamily
FT                   IIA hydrolase like protein; HAD-superfamily hydrolase,
FT                   subfamily IIA; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73357"
FT                   /db_xref="GOA:A0A0F6BIV6"
FT                   /db_xref="InterPro:IPR006354"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV6"
FT                   /inference="protein motif:TFAM:TIGR01457"
FT                   /protein_id="ADP73357.1"
FT                   /translation="MLKKYKGYLIDLDGTMYRGTECIAEARDFVKALYQKGIPYLFVTN
FT                   NSSRTPAQVAEKLQSFGVPATEEHVFTTSQATANYIFEKKPDASIYVIGEEGLRTALEE
FT                   KGFAFAKEDAEFVVMGIDRNITYEKLAIACLAVRNGATFISTNADIALPTERGLLPGNG
FT                   SLTAVVAVSTQVQPIFIGKPEKIIMEQALKVLGVPREETLMIGDYYDTDIMAGMNAGVD
FT                   TLLVHTGVTTKELLQRYEKQPTYTADSLKEWIDRI"
     MLKKYKGYLI DLDGTMYRGT ECIAEARDFV KALYQKGIPY LFVTNNSSRT PAQVAEKLQS        60
     FGVPATEEHV FTTSQATANY IFEKKPDASI YVIGEEGLRT ALEEKGFAFA KEDAEFVVMG       120
     IDRNITYEKL AIACLAVRNG ATFISTNADI ALPTERGLLP GNGSLTAVVA VSTQVQPIFI       180
     GKPEKIIMEQ ALKVLGVPRE ETLMIGDYYD TDIMAGMNAG VDTLLVHTGV TTKELLQRYE       240
     KQPTYTADSL KEWIDRI                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page