(data stored in ACNUC7421 zone)

EMBL: CP002293.PE505

CP002293.PE505       Location/Qualifiers
FT   CDS             561931..563232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0529"
FT                   /product="homoserine dehydrogenase"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; amino acid-binding ACT domain
FT                   protein; KEGG: gwc:GWCH70_2896 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73361"
FT                   /db_xref="GOA:A0A0F6BIW0"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW0"
FT                   /inference="protein motif:PFAM:PF00742"
FT                   /protein_id="ADP73361.1"
FT                   /translation="MAKPIFVGLLGLGTVGSGVVKIIENHQERLMHQVGCPVQVKKILV
FT                   RDIYKQRDVRVDPSLLTTDVADVIDDPEIDVVIEVMGGIEETREYLLRALQQGKHVVTA
FT                   NKDLMALHGSELLAVAAENHCDLFFEASVAGGIPILRSLVDGLASDRITKMMGIVNGTT
FT                   NYILTKMSKYGASYEEVLAEAQALGYAEADPTSDVEGLDAARKMAILARLGFSMNIDLE
FT                   DVQAKGITSITEEDLNYSKRLGYTMKLIGIAQRDGNKVEVSVQPTLLPDSHPLASVNDE
FT                   YNAVYVYGEAVGETMFYGPGAGSLPTATAVVSDLVAVMKNMRLGVNGCNAVAPQYEKQL
FT                   KSPSEIFSKYFLRIRVKDQVGAFAKITTLFSERGVSFEKILQLPLKEDGLAEIVIVTHR
FT                   ASQQDYEEILQQLRELEIVHEVKSSYRVEGEGKE"
     MAKPIFVGLL GLGTVGSGVV KIIENHQERL MHQVGCPVQV KKILVRDIYK QRDVRVDPSL        60
     LTTDVADVID DPEIDVVIEV MGGIEETREY LLRALQQGKH VVTANKDLMA LHGSELLAVA       120
     AENHCDLFFE ASVAGGIPIL RSLVDGLASD RITKMMGIVN GTTNYILTKM SKYGASYEEV       180
     LAEAQALGYA EADPTSDVEG LDAARKMAIL ARLGFSMNID LEDVQAKGIT SITEEDLNYS       240
     KRLGYTMKLI GIAQRDGNKV EVSVQPTLLP DSHPLASVND EYNAVYVYGE AVGETMFYGP       300
     GAGSLPTATA VVSDLVAVMK NMRLGVNGCN AVAPQYEKQL KSPSEIFSKY FLRIRVKDQV       360
     GAFAKITTLF SERGVSFEKI LQLPLKEDGL AEIVIVTHRA SQQDYEEILQ QLRELEIVHE       420
     VKSSYRVEGE GKE                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page