(data stored in ACNUC7421 zone)

EMBL: CP002293.PE506

CP002293.PE506       Location/Qualifiers
FT   CDS             563229..564290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0530"
FT                   /product="threonine synthase"
FT                   /note="KEGG: gwc:GWCH70_2895 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73362"
FT                   /db_xref="GOA:A0A0F6BIW1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW1"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADP73362.1"
FT                   /translation="MTWKGLLHAYREFLPINENTPMLTLNEGNTPLIPLPRLSEKLGVE
FT                   LYVKVEGANPTGSFKDRGMVMAVAKAKESGSHTIICASTGNTSASAAAYAARAGLRCIV
FT                   VIPNGKIAMGKLAQAVMYGAEIFAIEGNFDEALKMVRRLSDMAPITLVNSVNPYRIEGQ
FT                   KTAAFEICDQLGKAPDVLAIPVGNAGNITAYWKGFKEYHAAKQTGLPQMRGFEAEGAAA
FT                   IVRNQVIEHPETIATAIRIGNPASWEKAVQAAAESNGKIDEVSDAEIVEAYKLLAREEG
FT                   IFAEPASCASIAGVIKQRKRNEIEKGSTVVAVLTGNGLKDPAIAMEVAEIEPTVLANDE
FT                   TVVFEHIQGVVHQ"
     MTWKGLLHAY REFLPINENT PMLTLNEGNT PLIPLPRLSE KLGVELYVKV EGANPTGSFK        60
     DRGMVMAVAK AKESGSHTII CASTGNTSAS AAAYAARAGL RCIVVIPNGK IAMGKLAQAV       120
     MYGAEIFAIE GNFDEALKMV RRLSDMAPIT LVNSVNPYRI EGQKTAAFEI CDQLGKAPDV       180
     LAIPVGNAGN ITAYWKGFKE YHAAKQTGLP QMRGFEAEGA AAIVRNQVIE HPETIATAIR       240
     IGNPASWEKA VQAAAESNGK IDEVSDAEIV EAYKLLAREE GIFAEPASCA SIAGVIKQRK       300
     RNEIEKGSTV VAVLTGNGLK DPAIAMEVAE IEPTVLANDE TVVFEHIQGV VHQ              353
//

If you have problems or comments...

PBIL Back to PBIL home page