(data stored in ACNUC7421 zone)

EMBL: CP002293.PE507

CP002293.PE507       Location/Qualifiers
FT   CDS             564287..565201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0531"
FT                   /product="homoserine kinase"
FT                   /note="KEGG: gwc:GWCH70_2894 homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: GHMP kinase; GHMP kinase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73363"
FT                   /db_xref="GOA:A0A0F6BIW2"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW2"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ADP73363.1"
FT                   /translation="MKEDGMLRIVVPASTANLGPGFDSIGLAVSRYLTLEVRLADEWKF
FT                   VPRSSEVAAIPAGMDNLIYQVAAQVAQTYGCTLPSCFVDVYSNIPFTRGLGSSAAAVVA
FT                   GIELANELAGLSLSLEQKMRFASCYEGHPDNVGASLYGGLVIGSHRREETDVVHVPDVQ
FT                   LDLVAVIPSYELETEKARSVLPQMMAREDAVEASAVSNVLVAALLTKRWELAGKMMSCD
FT                   LFHQPYRKELVPQLSLVEKLAMQYGAFGVALSGAGPTILAFAEPGKGMELKEKLAPYFP
FT                   DCAVEWLTVEQKGSQVYKMSFEK"
     MKEDGMLRIV VPASTANLGP GFDSIGLAVS RYLTLEVRLA DEWKFVPRSS EVAAIPAGMD        60
     NLIYQVAAQV AQTYGCTLPS CFVDVYSNIP FTRGLGSSAA AVVAGIELAN ELAGLSLSLE       120
     QKMRFASCYE GHPDNVGASL YGGLVIGSHR REETDVVHVP DVQLDLVAVI PSYELETEKA       180
     RSVLPQMMAR EDAVEASAVS NVLVAALLTK RWELAGKMMS CDLFHQPYRK ELVPQLSLVE       240
     KLAMQYGAFG VALSGAGPTI LAFAEPGKGM ELKEKLAPYF PDCAVEWLTV EQKGSQVYKM       300
     SFEK                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page