(data stored in ACNUC7421 zone)

EMBL: CP002293.PE509

CP002293.PE509       Location/Qualifiers
FT   CDS             565585..565911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0533"
FT                   /product="Uncharacterized conserved protein UCP010603"
FT                   /note="PFAM: Uncharacterised conserved protein UCP010603;
FT                   KEGG: gwc:GWCH70_2892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73365"
FT                   /db_xref="InterPro:IPR009190"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038218"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW4"
FT                   /inference="protein motif:PFAM:PF07315"
FT                   /protein_id="ADP73365.1"
FT                   /translation="MTLKQVEICVYGADMICPSCVHLPSSKETYEWLEAAIKRKYPNQP
FT                   FSITYIDIFNPPEDDEAKKAFAKKVLEEDLFYPVVVIEGVIVGEGNPRLKSIYAEMEKY
FT                   GYRG"
     MTLKQVEICV YGADMICPSC VHLPSSKETY EWLEAAIKRK YPNQPFSITY IDIFNPPEDD        60
     EAKKAFAKKV LEEDLFYPVV VIEGVIVGEG NPRLKSIYAE MEKYGYRG                    108
//

If you have problems or comments...

PBIL Back to PBIL home page